Abstract: Seven B-cell IgE-binding epitopes(B1,B2,B3,B4,B5,B6,B7) and a T-cell epitope(T) in β-lactoglobulin from cow milk was used to design a tandem of multiple epitopes of the β-lactoglobulin from cow milk,in which the epitopes remain their independent antigenicity.According to the epitope tandem design principle,the linker between B cell epitopes is a glycine(G) while it is a di-lysine(KK) between T cell epitope and B cell epitope.The connection order of the eight epitopes was optimized through bioinformatics methods using the software of DNAStar and the network server-SOMPA.The optimized tandem molecular is:T-K-K-B1-G-B6-G-B5-G-B3-G-B7-G-B2-G-B4.And its amino acid sequence is:KIPAVFKIDALNENKVLVLDTKKLIVTQTMKGEVDDEALEKFDKALKALPGKTKIPAVFKIDAGKPTPEGDLEILLQ KGKALPMHIRLSFNGLLDAQSAPLRVYVEELKPGAQKKIIAEKTKI.The results showed that the molecular designation is correct,and the study methods are worth using reference to similar studies.

Key words: &beta, -lactoglobulin； tandem； epitope prediction； food allergy；